Collagen XIII alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10780

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Collagen XIII alpha 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CODA1. Peptide sequence PGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALM

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Collagen XIII alpha 1 Antibody - BSA Free

Western Blot: Collagen XIII alpha 1 Antibody [NBP3-10780]

Western Blot: Collagen XIII alpha 1 Antibody [NBP3-10780]

Western Blot: Collagen XIII alpha 1 Antibody [NBP3-10780] - Western blot analysis of Collagen XIII alpha 1 in 786-0 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for Collagen XIII alpha 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Collagen XIII alpha 1

COL13A1 encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined. Transcript Variant: This variant (1) encodes isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

COL13A1

Gene Symbol

COL13A1

Additional Collagen XIII alpha 1 Products

Product Documents for Collagen XIII alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Collagen XIII alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Extracellular Matrix Molecules

Customer Reviews for Collagen XIII alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Collagen XIII alpha 1 Antibody - BSA Free and earn rewards!

Have you used Collagen XIII alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail