Complement Component C5aR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21274

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Complement Component C5aR1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Complement Component C5aR1 Antibody - BSA Free (NBP3-21274) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Complement Component C5aR1 Antibody - BSA Free

Western Blot: Complement Component C5aR1 Antibody [NBP3-21274] -

Western Blot: Complement Component C5aR1 Antibody [NBP3-21274] -

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Applications for Complement Component C5aR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Component C5aR1

The human anaphylatoxin C5a is a 74 residue glycopeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. A variety of biological effects evoked by C5a can be demonstrated, rendering this molecule an important mediartor of inflammation, with granulocytes and macrophages as the main target cells. All cellular responses to C5a are specifically mediated by interactions with the membrane bound C5a receptor, a seven transmembrane GTP binding coupled receptor that belongs to the rhodopsin supergene family. C5a receptor 1 expression has been reported in myeloid blood cells, brain, liver, lung, spleen, heart, kidney, and intestinal tract. ESTs have been isolated from B cell/lung/testis, nerve, and placenta libraries.

Long Name

Complement Component C5a Receptor 1

Alternate Names

C5AR1, CD88, Complement Component C5a R1

Gene Symbol

C5AR1

Additional Complement Component C5aR1 Products

Product Documents for Complement Component C5aR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Complement Component C5aR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Complement Component C5aR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Component C5aR1 Antibody - BSA Free and earn rewards!

Have you used Complement Component C5aR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies