Connexin 45/GJC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59282

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Connexin 45/GJC1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GJC1(gap junction protein, gamma 1, 45kDa) The peptide sequence was selected from the middle region of GJC1. Peptide sequence ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Connexin 45/GJC1 Antibody - BSA Free

Western Blot: Connexin 45/GJC1 Antibody [NBP1-59282]

Western Blot: Connexin 45/GJC1 Antibody [NBP1-59282]

Western Blot: Connexin-45 Antibody [NBP1-59282] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Connexin 45/GJC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Connexin 45/GJC1

GJC1 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described.This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described.

Alternate Names

CX45, GJA7, GJC1

Gene Symbol

GJC1

UniProt

P36383 (Human)

Additional Connexin 45/GJC1 Products

Product Documents for Connexin 45/GJC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Connexin 45/GJC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Customer Reviews for Connexin 45/GJC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Connexin 45/GJC1 Antibody - BSA Free and earn rewards!

Have you used Connexin 45/GJC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies