COX15 Antibody (2D2) - Azide and BSA Free

Novus Biologicals | Catalog # H00001355-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH

Specificity

COX15 - COX15 homolog, cytochrome c oxidase assembly protein (yeast) (2D2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for COX15 Antibody (2D2) - Azide and BSA Free

Western Blot: COX15 Antibody (2D2) [H00001355-M01]

Western Blot: COX15 Antibody (2D2) [H00001355-M01]

Western Blot: COX15 Antibody (2D2) [H00001355-M01] - Analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2.Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: COX15 Antibody (2D2) [H00001355-M01] - Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.

Applications for COX15 Antibody (2D2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: COX15

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq]

Alternate Names

COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5

Entrez Gene IDs

1355 (Human)

Gene Symbol

COX15

Additional COX15 Products

Product Documents for COX15 Antibody (2D2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COX15 Antibody (2D2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COX15 Antibody (2D2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review COX15 Antibody (2D2) - Azide and BSA Free and earn rewards!

Have you used COX15 Antibody (2D2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...