COX7A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98535

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is COX7A1 - N-terminal region. Peptide sequence: SQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COX7A1 Antibody - BSA Free

Western Blot: COX7A1 Antibody [NBP1-98535]

Western Blot: COX7A1 Antibody [NBP1-98535]

Western Blot: COX7A1 Antibody [NBP1-98535] - Human Heart Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1.0 ug/ml Peptide Concentration: 2.0 ug/ml lysate Quantity: 25 ug/ Lane.
Western Blot: COX7A1 Antibody [NBP1-98535]

Western Blot: COX7A1 Antibody [NBP1-98535]

Western Blot: COX7A1 Antibody [NBP1-98535] - Human Heart lysate, concentration 1.0ug/ml.

Applications for COX7A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COX7A1

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes poly67 1 (muscle isoform) of subunit VIIa and the poly67 1 is present only in muscle tissues. Other poly67s of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.

Alternate Names

COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial

Gene Symbol

COX7A1

Additional COX7A1 Products

Product Documents for COX7A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COX7A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COX7A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COX7A1 Antibody - BSA Free and earn rewards!

Have you used COX7A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...