CRHR2/CRF2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-13875PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all CRHR2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRHR2.

Source: E. coli

Amino Acid Sequence: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13875.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-13875PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CRHR2

Official Gene Symbol: CRHR2 Gen Bank Accession Number: NP_001874 Gene ID: 1395 (Human) Gene Map Locus: 7p15.1 (Human) CRHR2 is a novel member of Secretin-family-GPCR proteins that functions as a functional receptor for CRF. It is expressed as 3 isoforms; alpha, beta and gamma. These isoforms primarily differ in their N-terminal sequence and tissue distribution. Apart from CRF, other ligands of CRHR2 include UcnI, UcnII and UcnIII. CRHR2 is involved in stress responses, cardiovascular function and gastric motility. Studies on CRHR2 deficient mice suggested a central anxiolytic effect of CRHR2. Northern Blot analysis detects CRHR2 expression in brain, hypothalamus, heart, GI, lung, skeletal muscle and vasculature.

Long Name

Corticotropin Releasing Hormone Receptor 2

Alternate Names

CRF-RB, CRF2, HM-CRF

Gene Symbol

CRHR2

Additional CRHR2 Products

Product Documents for CRHR2/CRF2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRHR2/CRF2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for CRHR2/CRF2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review CRHR2/CRF2 Recombinant Protein Antigen and earn rewards!

Have you used CRHR2/CRF2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes