CRLR Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59073

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CRLR Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CALCRL(calcitonin receptor-like) The peptide sequence was selected from the N terminal of CALCRL. Peptide sequence DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35115501).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CRLR Antibody - BSA Free

Western Blot: CRLR Antibody [NBP1-59073]

Western Blot: CRLR Antibody [NBP1-59073]

Western Blot: CALCRL Antibody [NBP1-59073] - Human Fetal Muscle lysate, concentration 0.2-1 ug/ml.

Applications for CRLR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRLR

CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Long Name

Calcitonin Receptor-like Receptor

Alternate Names

CALCRL, CGRPR

Gene Symbol

CALCRL

UniProt

Q16602

Additional CRLR Products

Product Documents for CRLR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRLR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CRLR Antibody - BSA Free

Customer Reviews for CRLR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRLR Antibody - BSA Free and earn rewards!

Have you used CRLR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for CRLR Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All

  • Q: I'd like to know if this antibody CALCRL Antibody (NBP1-59073) is indeed against the calcitonin gene-related peptide receptor in human, mouse and rat. I'm not familiar with the short form in your description and just like to be sure.

    A: This antibody has been validated for use in detecting CALCRL in human mouse and rat. CALCRL is the same as calcitonin gene-related peptide receptor. Please see https://www.uniprot.org/uniprotkb/Q16602/entry for more information.

  • Q: Please, I need the concentration of the current lot of this Ab: CALCRL Antibody (NBP1-59073).

    A: This product is lyophilized. We suggest reconstituting to 1mg/mL.

  • Q: I'd like to know if this antibody CALCRL Antibody (NBP1-59073) is indeed against the calcitonin gene-related peptide receptor in human, mouse and rat. I'm not familiar with the short form in your description and just like to be sure.

    A: This antibody has been validated for use in detecting CALCRL in human mouse and rat. CALCRL is the same as calcitonin gene-related peptide receptor. Please see https://www.uniprot.org/uniprotkb/Q16602/entry for more information.

  • Q: Please, I need the concentration of the current lot of this Ab: CALCRL Antibody (NBP1-59073).

    A: This product is lyophilized. We suggest reconstituting to 1mg/mL.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies