CYP27C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56523

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CYP27C1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CYP27C1(cytochrome P450, family 27, subfamily C, polypeptide 1) The peptide sequence was selected from the middle region of CYP27C1. Peptide sequence VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CYP27C1 Antibody - BSA Free

Western Blot: CYP27C1 Antibody [NBP1-56523]

Western Blot: CYP27C1 Antibody [NBP1-56523]

Western Blot: CYP27C1 Antibody [NBP1-56523] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Applications for CYP27C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP27C1

The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Alternate Names

cytochrome P450 27C1, cytochrome P450, family 27, subfamily C, polypeptide 1, cytochrome P450, family 27, subfamily C, polypeptide 13, EC 1.14, FLJ16008

Gene Symbol

CYP27C1

UniProt

Q4G0S4 (Human)

Additional CYP27C1 Products

Product Documents for CYP27C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CYP27C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP27C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP27C1 Antibody - BSA Free and earn rewards!

Have you used CYP27C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies