Cystatin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92605

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cystatin-8 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cystatin-8 Antibody - BSA Free

Western Blot: Cystatin-8 AntibodyBSA Free [NBP2-92605]

Western Blot: Cystatin-8 AntibodyBSA Free [NBP2-92605]

Western Blot: Cystatin-8 Antibody [NBP2-92605] - Analysis of extracts of various cell lines, using Cystatin-8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Cystatin-8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cystatin-8

Cystatin 8, also referred to as CST8, has a 142 amino acid isoform that is 16 kDa, and is involved in reproduction, especially pertaining to sperm development and maturation. Disease research is being conducted between Cystatin 8 and several diseases and disorders to determine the relation between the two. Some of these disorders include epididymitis, cerebral hemorrhage, melanoma, t-cell leukemia, cerebritis, and choriocarcinoma. This protein is not linked to any pathways, and is not known to interact with any other proteins at this time.

Alternate Names

CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific

Gene Symbol

CST8

Additional Cystatin-8 Products

Product Documents for Cystatin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cystatin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cystatin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cystatin-8 Antibody - BSA Free and earn rewards!

Have you used Cystatin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies