DCNP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14415

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DCNP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DCNP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DCNP1 Antibody [NBP2-14415]

Immunohistochemistry-Paraffin: DCNP1 Antibody [NBP2-14415]

Immunohistochemistry-Paraffin: DCNP1 Antibody [NBP2-14415] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
DCNP1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: DCNP1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: DCNP1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-DCNP1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for DCNP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCNP1

C5orf20 is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleus. One of the alleles (A/T) of this gene, that causes premature translation termination at aa 117, has been associated with an increased prevalence of major depression in humans.

Alternate Names

C5orf20, chromosome 5 open reading frame 20, DCNP1 dendritic cell nuclear protein 1

Gene Symbol

C5ORF20

Additional DCNP1 Products

Product Documents for DCNP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DCNP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCNP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCNP1 Antibody - BSA Free and earn rewards!

Have you used DCNP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies