DCUN1D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84763

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DCUN1D2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DCUN1D2. Peptide sequence: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DCUN1D2 Antibody - BSA Free

Western Blot: DCUN1D2 Antibody [NBP2-84763]

Western Blot: DCUN1D2 Antibody [NBP2-84763]

Western Blot: DCUN1D2 Antibody [NBP2-84763] - Host: Rabbit. Target Name: Dcun1d2. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for DCUN1D2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCUN1D2

DCUN1D2 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-typecomplexes activity

Alternate Names

C13orf17, chromosome 13 open reading frame 17, DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae), DCN1-like protein 2, DCUN1 domain-containing protein 2, DCUN1L2, Defective in cullin neddylation protein 1-like protein 2, FLJ10704, FLJ20092

Gene Symbol

DCUN1D2

Additional DCUN1D2 Products

Product Documents for DCUN1D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DCUN1D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCUN1D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCUN1D2 Antibody - BSA Free and earn rewards!

Have you used DCUN1D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies