DEDD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88800

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DEDD2. Peptide sequence: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DEDD2 Antibody - BSA Free

Western Blot: DEDD2 Antibody [NBP2-88800]

Western Blot: DEDD2 Antibody [NBP2-88800]

Western Blot: DEDD2 Antibody [NBP2-88800] - WB Suggested Anti-DEDD2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Lung

Applications for DEDD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEDD2

Apoptosis and inflammation are important cellular processes that are highly regulated through specific protein-protein interactions (PPI). Proteins involved in these signaling cascades often carry PPI domains belonging to the death-domain superfamily (reviewed in Kohl A and MG Grutter, 2004). These PPI domains include the death effector domain (DED), the death domain (DD), the caspase activation and recruitment domain (CARD) and the pyrin domain (PYD). PPI domains are structurally related and comprised of a six alpha helical structure; within proteins PPI domains can be found in isolation or in combination with other domains. DEDD2/Flame-3 (DED containing DNA binding2) belongs to a family of single DED-containing proteins that is targeted to the nucleus (reviewed in Barnhart et al, 2003; Slvibst ry sl, 2003). Several DED-containing proteins are involved in the regulation of apoptosis through their interactions with DED-containing caspases. It is thought that DEDD2 and its closely related homologue DEDD may mediate cell death by binding to the DED-containing caspases -8 and -10, and targeting them to the nucleus following death receptor induced apoptosis. However, the function of DEDD2 and DEDD remain to be fully elucidated, and they may also have roles in cellular processes other than apoptosis. This antibody recognizes DEDD2/Flame-3; human DED2/Flame-3 is a 326 amino acid protein.

Alternate Names

death effector domain containing 2, death effector domain-containing DNA binding protein 2, DED-containing protein FLAME-3, DNA-binding death effector domain-containing protein 2, FADD-like apoptotic molecule 3, FLAME3, FLAME-3

Gene Symbol

DEDD2

Additional DEDD2 Products

Product Documents for DEDD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEDD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DEDD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DEDD2 Antibody - BSA Free and earn rewards!

Have you used DEDD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...