Desmocollin-3 Antibody (7H1O6)

Novus Biologicals | Catalog # NBP3-15266

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7H1O6 expressed in HEK293
View all Desmocollin-3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 797-896 of human Desmocollin-3 (Q14574). HHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNEDRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Desmocollin-3 Antibody (7H1O6)

Western Blot: Desmocollin-3 Antibody (7H1O6) [NBP3-15266]

Western Blot: Desmocollin-3 Antibody (7H1O6) [NBP3-15266]

Western Blot: Desmocollin-3 Antibody (7H1O6) [NBP3-15266] - Western blot analysis of extracts of TE-1 cells, using Desmocollin-3 antibody (NBP3-15266) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Applications for Desmocollin-3 Antibody (7H1O6)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Desmocollin-3

Desmocollin 3 is encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms.

Alternate Names

CDHF3, Desmocollin3, DSC3, DSC4, HT-CP

Gene Symbol

DSC3

Additional Desmocollin-3 Products

Product Documents for Desmocollin-3 Antibody (7H1O6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Desmocollin-3 Antibody (7H1O6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cadherin Superfamily

Customer Reviews for Desmocollin-3 Antibody (7H1O6)

There are currently no reviews for this product. Be the first to review Desmocollin-3 Antibody (7H1O6) and earn rewards!

Have you used Desmocollin-3 Antibody (7H1O6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies