DFF40/CAD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55648

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN

Reactivity Notes

Mouse 84%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DFF40/CAD Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DFF40/CAD Antibody [NBP2-55648]

Immunocytochemistry/ Immunofluorescence: DFF40/CAD Antibody [NBP2-55648]

Immunocytochemistry/Immunofluorescence: DFF40/CAD Antibody [NBP2-55648] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.

Applications for DFF40/CAD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DFF40/CAD

Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. These death signals finally cause the degradation of chromosomal DNA by activated DNase. A mouse DNase that causes DNA fragmentation was identified recently and designated CAD (for caspase activated deoxyribonuclease). The human homologue of mouse CAD was more recently identified by two groups independently and termed CPAN and DFF40. Human DFF45 and its mouse homologue ICAD are the inhibitors of CPAN/DFF40 and CAD, respectively (1, 2, 5). Upon cleavage of DFF45/ICAD by activated caspase, DFF40/CAD is released and activated and eventually causes the degradation of DNA in the nuclei. Activation of CAD/DFF40, which causes DNA degradation, is the hallmark of apoptotic cell death.

Long Name

DNA Fragmentation Factor, Subunit beta

Alternate Names

CAD, CPAN, DFF2, DFFB

Gene Symbol

DFFB

Additional DFF40/CAD Products

Product Documents for DFF40/CAD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DFF40/CAD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DFF40/CAD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DFF40/CAD Antibody - BSA Free and earn rewards!

Have you used DFF40/CAD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for DFF40/CAD Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Does Novus offer any CAD (caspase activated DNase) antibodies that specifically look at the activation state of CAD? And if so, how well does this antibody work with chicken?

    A: CAD/DFF40/DFFB is inhibited by being bound by DFFA. Because of this manner of inhibition, antibodies will not be able to recognize the difference between activated and inhibited DFFB, so we do not have a product specifically for activated or inhibited DFFB and this product will probably be nearly impossible to make. Unfortunately, the human and chicken sequence appear to be divergent for any of our immunogens to recommend any antibody to test for cross-reactivity with chicken. I apologize for the inconvenience.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...