DGAT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92727

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DGAT2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2). IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DGAT2 Antibody - BSA Free

Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]

Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]

Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of various cell lines, using DGAT2 antibody (NBP2-92727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]

Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]

Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of Rat liver cells, using DGAT2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.(Exposure time: 60s).

Applications for DGAT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DGAT2

Acyl-CoA:diacylglycerol acyltransferase, or DGAT (EC 2.3.1.20), is responsible for the synthesis of triglycerides. It catalyzes a reaction in which diacylglycerol is covalently joined to long chain fatty acyl-CoAs.

Long Name

Diacylglycerol O-Acyltransferase 2

Alternate Names

diacylglycerol O-acyltransferase 2, diacylglycerol O-acyltransferase homolog 2, diacylglycerol O-acyltransferase homolog 2 (mouse), diacylglycerol O-acyltransferase-like protein 2, Diglyceride acyltransferase 2, DKFZp686A15125, EC 2.3.1, EC 2.3.1.20, GS1999FULL

Gene Symbol

DGAT2

Additional DGAT2 Products

Product Documents for DGAT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DGAT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Obesity

Customer Reviews for DGAT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGAT2 Antibody - BSA Free and earn rewards!

Have you used DGAT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies