DGAT2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92727
Loading...
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2). IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for DGAT2 Antibody - BSA Free
Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]
Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of various cell lines, using DGAT2 antibody (NBP2-92727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.Western Blot: DGAT2 AntibodyAzide and BSA Free [NBP2-92727]
Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of Rat liver cells, using DGAT2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.(Exposure time: 60s).Applications for DGAT2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: DGAT2
Long Name
Diacylglycerol O-Acyltransferase 2
Alternate Names
diacylglycerol O-acyltransferase 2, diacylglycerol O-acyltransferase homolog 2, diacylglycerol O-acyltransferase homolog 2 (mouse), diacylglycerol O-acyltransferase-like protein 2, Diglyceride acyltransferase 2, DKFZp686A15125, EC 2.3.1, EC 2.3.1.20, GS1999FULL
Gene Symbol
DGAT2
Additional DGAT2 Products
Product Documents for DGAT2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DGAT2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Customer Reviews for DGAT2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DGAT2 Antibody - BSA Free and earn rewards!
Have you used DGAT2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...