DGK-epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59067

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DGK-epsilon Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DGK-epsilon Antibody - BSA Free

Western Blot: DGK-epsilon Antibody [NBP1-59067]

Western Blot: DGK-epsilon Antibody [NBP1-59067]

Western Blot: DGK-epsilon Antibody [NBP1-59067] - DGKE antibody - N-terminal region validated by WB using lymph at 1:1000.
Western Blot: DGK-epsilon Antibody [NBP1-59067]

Western Blot: DGK-epsilon Antibody [NBP1-59067]

Western Blot: DGK-epsilon Antibody [NBP1-59067] - WB Suggested Anti-DGKE Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human brain

Applications for DGK-epsilon Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGK-epsilon

Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.

Long Name

Diacylglycerol Kinase, epsilon 64kDa

Alternate Names

DAGK5, DAGK6, DGKE, DGKepsilon

Gene Symbol

DGKE

UniProt

P52429

Additional DGK-epsilon Products

Product Documents for DGK-epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DGK-epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases

Customer Reviews for DGK-epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGK-epsilon Antibody - BSA Free and earn rewards!

Have you used DGK-epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies