Dihydrofolate Reductase/DHFR Antibody (7N3X4)

Novus Biologicals | Catalog # NBP3-16805

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7N3X4 expressed in HEK293
View all Dihydrofolate Reductase/DHFR Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 88-187 of human Dihydrofolate Reductase/DHFR (NP_000782.1). HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dihydrofolate Reductase/DHFR Antibody (7N3X4)

Western Blot: Dihydrofolate Reductase/DHFR Antibody (7N3X4) [NBP3-16805]

Western Blot: Dihydrofolate Reductase/DHFR Antibody (7N3X4) [NBP3-16805]

Western Blot: Dihydrofolate Reductase/DHFR Antibody (7N3X4) [NBP3-16805] - Western blot analysis of extracts of various cell lines, using Dihydrofolate Reductase/DHFR Rabbit mAb (NBP3-16805) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for Dihydrofolate Reductase/DHFR Antibody (7N3X4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dihydrofolate Reductase/DHFR

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia.

Alternate Names

DHFR, DHFRP1, DYR

Gene Symbol

DHFR

Additional Dihydrofolate Reductase/DHFR Products

Product Documents for Dihydrofolate Reductase/DHFR Antibody (7N3X4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dihydrofolate Reductase/DHFR Antibody (7N3X4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for Dihydrofolate Reductase/DHFR Antibody (7N3X4)

There are currently no reviews for this product. Be the first to review Dihydrofolate Reductase/DHFR Antibody (7N3X4) and earn rewards!

Have you used Dihydrofolate Reductase/DHFR Antibody (7N3X4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies