DLL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10597

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DLL3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DLL3 (NP_982353). Peptide sequence LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DLL3 Antibody - BSA Free

Western Blot: DLL3 Antibody [NBP3-10597]

Western Blot: DLL3 Antibody [NBP3-10597]

Western Blot: DLL3 Antibody [NBP3-10597] - Western blot analysis of DLL3 in Hela Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for DLL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DLL3

The DLL3 gene encodes a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostos

Long Name

Delta-like 3

Alternate Names

Pudgy, SCDO1

Gene Symbol

DLL3

Additional DLL3 Products

Product Documents for DLL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DLL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Notch Pathway

Customer Reviews for DLL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DLL3 Antibody - BSA Free and earn rewards!

Have you used DLL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail