DNAH6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82889

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DNAH6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DNAH6. Peptide sequence: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DNAH6 Antibody - BSA Free

Western Blot: DNAH6 Antibody [NBP2-82889]

Western Blot: DNAH6 Antibody [NBP2-82889]

Western Blot: DNAH6 Antibody [NBP2-82889] - Host: Rabbit. Target Name: DYH6. Sample Type: HCT15 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for DNAH6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAH6

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains.Two major classes of dyneins, axonemal and cytoplasmic, have been identified. DNAH6 is an axonemal dynein heavy chain(DHC) (Vaughan et al., 1996 (PubMed 8812413)).(supplied by OMIM)

Alternate Names

axonemal, Ciliary dynein heavy chain 6, Dnahc6, DNHL1, dynein heavy chain-like 1, dynein, axonemal, heavy chain 6, dynein, axonemal, heavy polypeptide 6, FLJ23529, FLJ37357, HL-2, HL2DKFZp667K087, KIAA1697, MGC132544, MGC141984, MGC177197

Gene Symbol

DNAH6

Additional DNAH6 Products

Product Documents for DNAH6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAH6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAH6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAH6 Antibody - BSA Free and earn rewards!

Have you used DNAH6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies