DPYS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85224

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DPYS Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DPYS Antibody - BSA Free

Western Blot: DPYS Antibody [NBP1-85224]

Western Blot: DPYS Antibody [NBP1-85224]

Western Blot: DPYS Antibody [NBP1-85224] - Analysis in control (vector only transfected HEK293T lysate) and DPYS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224] - Analysis in human liver and pancreas tissues using Anti-DPYS antibody. Corresponding DPYS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224]

Immunohistochemistry-Paraffin: DPYS Antibody [NBP1-85224] - Staining of human liver shows high expression.

Applications for DPYS Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPYS

DPYS, also known as Dihydropyrimidinase, is a 56.6 kDa, 519 amino acid protein that is involved in catalyzing the reaction of 5,6-dihydrouracil in to 3-ureidopropionate in the second step of pyrimidine reduction and degradation. Diseases and disorders such as pneumonia, beriberi, convulsions, carcinoma, neuronitis, tuberculosis, dihydropyrimidinuria, gastric cancer, and papillon-lefevre disease have been studied with this protein. The protein interacts in pyrimidine metabolism, beta-alanine metabolism, thymine degradation, and drug metabolism pathways with DPYD, UPB1, and DPYSL5.

Alternate Names

DHPasehydantoinase, DHPHydantoinase, dihydropyrimidinase, Dihydropyrimidine amidohydrolase, EC 3.5.2.2

Gene Symbol

DPYS

Additional DPYS Products

Product Documents for DPYS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DPYS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPYS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPYS Antibody - BSA Free and earn rewards!

Have you used DPYS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies