DRAM Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88807

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DRAM Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DRAM. Peptide sequence: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit DRAM Antibody - BSA Free (NBP2-88807) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for DRAM Antibody - BSA Free

Western Blot: DRAM Antibody [NBP2-88807]

Western Blot: DRAM Antibody [NBP2-88807]

Western Blot: DRAM Antibody [NBP2-88807] - WB Suggested Anti-DRAM Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: A549 cell lysateDRAM1 is supported by BioGPS gene expression data to be expressed in A549

Applications for DRAM Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DRAM

DRAM is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.; Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy.

Alternate Names

Damage-regulated autophagy modulator, DNA damage-regulated autophagy modulator protein 1, DNA-damage regulated autophagy modulator 1, DRAMFLJ11259

Gene Symbol

DRAM1

Additional DRAM Products

Product Documents for DRAM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DRAM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DRAM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DRAM Antibody - BSA Free and earn rewards!

Have you used DRAM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies