EBI2/GPR183 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86626

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EBI2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EBI2/GPR183. Peptide sequence: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit EBI2/GPR183 Antibody - BSA Free (NBP2-86626) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for EBI2/GPR183 Antibody - BSA Free

Western Blot: EBI2/GPR183 Antibody [NBP2-86626]

Western Blot: EBI2/GPR183 Antibody [NBP2-86626]

Western Blot: EBI2/GPR183 Antibody [NBP2-86626] - WB Suggested Anti-GPR183 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for EBI2/GPR183 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EBI2

EBI2 is an Orphan-A GPCR with an unknown ligand. It has a probable role as a mediator of EBV effects on B-lymphocyte and lymphoid tissues but not in T-lymphocyte or peripheral-blood T lymphocytes. EBI2 expression has been documented in B-lymphocyte cell lines and in lymphoid and pulmonary tissues. ESTs have been isolated from normal blood, breast, vessel, thymus, tonsil, lymph, ear, and fetal lung, testis, and B-cell libraries. ESTs have also been isolated from blood, bone marrow, breast, ear, ganglion, lung, lymph node, placenta, thymus, tonsil, and vessel cancer libraries.

Long Name

Epstein-Barr Virus Induced Gene 2

Alternate Names

GPR183

Gene Symbol

GPR183

Additional EBI2 Products

Product Documents for EBI2/GPR183 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EBI2/GPR183 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EBI2/GPR183 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EBI2/GPR183 Antibody - BSA Free and earn rewards!

Have you used EBI2/GPR183 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies