eIF3K Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91865

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eIF3K Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for eIF3K Antibody - BSA Free

Western Blot: eIF3K Antibody [NBP1-91865]

Western Blot: eIF3K Antibody [NBP1-91865]

Western Blot: eIF3K Antibody [NBP1-91865] - Analysis using Anti-EIF3K antibody NBP1-91865 (A) shows similar pattern to independent antibody NBP2-56764 (B).
Immunohistochemistry-Paraffin: eIF3K Antibody [NBP1-91865]

Immunohistochemistry-Paraffin: eIF3K Antibody [NBP1-91865]

Immunohistochemistry-Paraffin: eIF3K Antibody [NBP1-91865] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
eIF3K Antibody - BSA Free Western Blot: eIF3K Antibody - BSA Free [NBP1-91865]

Western Blot: eIF3K Antibody - BSA Free [NBP1-91865]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for eIF3K Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF3K

The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM]

Alternate Names

ARG134, eIF3k, EIF3-p28, EIF3S12eIF-3 p28, Eukaryotic translation initiation factor 3 subunit 12, eukaryotic translation initiation factor 3 subunit K, eukaryotic translation initiation factor 3, subunit 12, eukaryotic translation initiation factor 3, subunit K, HSPC029, M9, MSTP001, muscle specific, Muscle-specific gene M9 protein, PLAC24, PLAC-24, PLAC-24eIF-3 p25, PRO1474, PTD001

Entrez Gene IDs

27335 (Human)

Gene Symbol

EIF3K

UniProt

Q9UBQ5 (Human)

Additional eIF3K Products

Product Documents for eIF3K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eIF3K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF3K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF3K Antibody - BSA Free and earn rewards!

Have you used eIF3K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies