Recombinant Human EMP2 GST (N-Term) Protein

Name: Recombinant Human EMP2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002013-P01
Price: 749 USD
Availability: InStock
Rating: 5 (2 reviews)

Novus Biologicals | Catalog # H00002013-P01

(2)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all EMP2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human EMP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

45.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Reviewed Applications

Read 2 reviews rated 5 using H00002013-P01 in the following applications:

ELISA (1 Review)
Western Blot (1 Review)

Scientific Data Images for Recombinant Human EMP2 GST (N-Term) Protein

Western Blot: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]

Western Blot: EMP2 Recombinant Protein [H00002013-P01] - analysis of EMP2 using anti-EMP2 antibody (Cat.# NBP1-86847). The EMP2 recombinant protein was used as a positive control. Image from verified customer review.

12.5% SDS-PAGE Stained with Coomassie Blue.

ELISA: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]

ELISA: EMP2 Recombinant Protein [H00002013-P01] - EMP2 recombinant protein coated into ELISA plate; used as a positive control for EMP2 antibody (Cat# NBP1-86847). Image from verified customer review.

Formulation, Preparation, and Storage

H00002013-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: EMP2

Epithelial membrane protein-2 (EMP2), a tetraspan protein known to associate with and modify surface expression of certain integrin isoforms, was identified as a prognostic biomarker in human endometrial cancer. EMP2 is expressed in the majority of ovarian tumors and may be a feasible drug target in vivo. EMP2 in several cell types plays a role in growth control, invasion, metastasis, and protein trafficking. It can associate with integrin alpha v beta 3 and FAK, and promote integrin-mediated FAK-Src activation.

Long Name

Epithelial Membrane Protein 2

Alternate Names

XMP

Gene Symbol

EMP2

Additional EMP2 Products

Product Documents for Recombinant Human EMP2 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human EMP2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Integrins and Associated Molecules

Customer Reviews for Recombinant Human EMP2 GST (N-Term) Protein (2)

5 out of 5

2 Customer Ratings

5 Stars

100%

4 Stars

3 Stars

2 Stars

1 Stars

Have you used Recombinant Human EMP2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

Customer Images

Showing 1 - 2 of 2 reviews Showing All

Filter By:

Name: Anonymous

Application: ELISA

Sample Tested: EMP2 Recombinant Protein (H00002013-P01)

Species: Human

Verified Customer | Posted 10/02/2015

EMP2 Recombinant protein for ELISA
Name: Anonymous

Application: Western Blot

Sample Tested: EMP2 (NP_001415.1, 1 a.a. - 167 a.a.) recombinant protein with a ~26kD N-terminal GST tag.

Species: Other

Verified Customer | Posted 03/13/2015

EMP2 REC protein

There are no reviews that match your criteria.