Ephrin-B3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10672

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Ephrin-B3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ephrin-B3 (NP_031937). Peptide sequence AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ephrin-B3 Antibody - BSA Free

Western Blot: Ephrin-B3 Antibody [NBP3-10672]

Western Blot: Ephrin-B3 Antibody [NBP3-10672]

Western Blot: Ephrin-B3 Antibody [NBP3-10672] - Western blot analysis of Ephrin-B3 in Mouse Spleen lysates. Antibody dilution at 1.0ug/ml

Applications for Ephrin-B3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ephrin-B3

Ephrins are the ligands which bind to the Eph receptor subfamily, the largest group of the receptor tyrosine kinase family. Both ephrins and Eph receptors are broadly expressed throughout the ectoderm, mesoderm, and endoderm of vertebrate embryos. Two classes of ephrins exist: Class A ephrins are tethered to the membrane by a GPI linkage and bind primarily to EphA receptors; Class B ephrins contain a membrane-spanning region and bind predominantly to EphB receptors.

Alternate Names

EFL-6, Efnb3, Elk-L3, EphrinB3, Epl8, LERK-8, NLERK-2

Gene Symbol

EFNB3

Additional Ephrin-B3 Products

Product Documents for Ephrin-B3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ephrin-B3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ephrin Ligands and Eph Receptors

Customer Reviews for Ephrin-B3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ephrin-B3 Antibody - BSA Free and earn rewards!

Have you used Ephrin-B3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies