ESCO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87372

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ESCO2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ESCO2. Peptide sequence: IYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ESCO2 Antibody - BSA Free

Western Blot: ESCO2 Antibody [NBP2-87372]

Western Blot: ESCO2 Antibody [NBP2-87372]

Western Blot: ESCO2 Antibody [NBP2-87372] - Host: Rabbit. Target Name: ESCO2. Sample Tissue: Thymus Tumor lysates. Antibody Dilution: 1ug/ml

Applications for ESCO2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ESCO2

ESCO2 encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. [provided by RefSeq]

Alternate Names

2410004I17Rik, EC 2.3.1.-, ECO1 homolog 2, EFO2, Establishment of cohesion 1 homolog 2, establishment of cohesion 1 homolog 2 (S. cerevisiae), N-acetyltransferase ESCO2, RBS, Roberts syndrome

Gene Symbol

ESCO2

Additional ESCO2 Products

Product Documents for ESCO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ESCO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ESCO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ESCO2 Antibody - BSA Free and earn rewards!

Have you used ESCO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies