Eukaryotic translation initiation factor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98556

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Eukaryotic translation initiation factor 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Eukaryotic translation initiation factor 1 - middle region. Peptide sequence DKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Eukaryotic translation initiation factor 1 Antibody - BSA Free

Western Blot: Eukaryotic translation initiation factor 1 Antibody [NBP1-98556]

Western Blot: Eukaryotic translation initiation factor 1 Antibody [NBP1-98556]

Western Blot: Eukaryotic translation initiation factor 1 Antibody [NBP1-98556] - Antibody Dilution: 1.0ug/ml Sample Tissue: MCF7 cell lysate.

Applications for Eukaryotic translation initiation factor 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Eukaryotic translation initiation factor 1

EIF1 is necessary for scanning and involved in initiation site selection. EIF1 promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Alternate Names

A121Protein translation factor SUI1 homolog, eIF1, EIF-1, EIF1A, eukaryotic translation initiation factor 1, ISO1, Sui1iso1, SUI1sui1iso1

Gene Symbol

EIF1

UniProt

NP_005792 (Human)

Additional Eukaryotic translation initiation factor 1 Products

Product Documents for Eukaryotic translation initiation factor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Eukaryotic translation initiation factor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Eukaryotic translation initiation factor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Eukaryotic translation initiation factor 1 Antibody - BSA Free and earn rewards!

Have you used Eukaryotic translation initiation factor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies