EVER2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57812

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EVER2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TMC8 (transmembrane channel-like 8) The peptide sequence was selected from the N terminal of TMC8)(50ug). Peptide sequence PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG. The peptide sequence for this immunogen was taken from within the described region.

Localization

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EVER2 Antibody - BSA Free

Western Blot: EVER2 Antibody [NBP1-57812]

Western Blot: EVER2 Antibody [NBP1-57812]

Western Blot: EVER2 Antibody [NBP1-57812] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for EVER2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EVER2

Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 8 predicted transmembrane domains and 3 leucine zipper motifs.

Alternate Names

epidermodysplasia verruciformis 2, Epidermodysplasia verruciformis protein 2, EV2, EVER2MGC102701, EVIN2FLJ43684, FLJ40668, MGC40121, transmembrane channel-like 8, transmembrane channel-like protein 8

Entrez Gene IDs

147138 (Human)

Gene Symbol

TMC8

UniProt

Q8IU68 (Human)

Additional EVER2 Products

Product Documents for EVER2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EVER2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EVER2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EVER2 Antibody - BSA Free and earn rewards!

Have you used EVER2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies