FAM20C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70767

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAM20C Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FAM20C (family with sequence similarity 20, member C). The peptide sequence was selected from the middle region of FAM20C. Peptide sequence CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FAM20C Antibody - BSA Free

Western Blot: FAM20C Antibody [NBP1-70767]

Western Blot: FAM20C Antibody [NBP1-70767]

Western Blot: FAM20C Antibody [NBP1-70767] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for FAM20C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM20C

FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Long Name

Family with Sequence Similarity 20, Member C

Alternate Names

DMP4, GEF-CK, RNS

Gene Symbol

FAM20C

Additional FAM20C Products

Product Documents for FAM20C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAM20C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases

Customer Reviews for FAM20C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM20C Antibody - BSA Free and earn rewards!

Have you used FAM20C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for FAM20C Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Does this product recognize murine fam20c? I see a blot against HepG2 lysate which is human. Do you have similar data for mouse? Either mouse cell lines or transfected mouse DNA?

    A: The immunogen for this antibody shares 100% similarity with mouse so it should cross-react. This is why we have mouse listed on our datasheet.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies