FARSB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38917

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FARSB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FARSB Antibody - BSA Free

Western Blot: FARSB Antibody [NBP2-38917]

Western Blot: FARSB Antibody [NBP2-38917]

Western Blot: FARSB Antibody [NBP2-38917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917] - Staining in human testis and liver tissues using anti-FARSB antibody. Corresponding FARSB RNA-seq data are presented for the same tissues.
Immunohistochemistry: FARSB Antibody [NBP2-38917]

Immunohistochemistry: FARSB Antibody [NBP2-38917]

Immunohistochemistry: FARSB Antibody [NBP2-38917] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917]

Immunohistochemistry-Paraffin: FARSB Antibody [NBP2-38917] - Staining of human testis shows high expression.

Applications for FARSB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FARSB

FARSB encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified.

Alternate Names

EC 6.1.1, EC 6.1.1.20, FARSLBphenylalanine-tRNA ligase beta chain, FRSBphenylalanine tRNA ligase 1, beta, cytoplasmic, PheHB, Phenylalanine--tRNA ligase beta chain, phenylalanine-tRNA synthetase-like, beta subunit, phenylalanyl-tRNA synthetase beta chain, phenylalanyl-tRNA synthetase beta-subunit, phenylalanyl-tRNA synthetase, beta subunit, phenylalanyl-tRNA synthetase-like, beta subunit, PheRS

Gene Symbol

FARSB

UniProt

Q9NSD9 (Human)

Additional FARSB Products

Product Documents for FARSB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FARSB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FARSB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FARSB Antibody - BSA Free and earn rewards!

Have you used FARSB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies