FCRL6/FcRH6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10580

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FCRL6/FcRH6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FCRL6/FcRH6. Peptide sequence HSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FCRL6/FcRH6 Antibody - BSA Free

Western Blot: FCRL6/FcRH6 Antibody [NBP3-10580]

Western Blot: FCRL6/FcRH6 Antibody [NBP3-10580]

Western Blot: FCRL6/FcRH6 Antibody [NBP3-10580] - Western blot analysis of FCRL6/FcRH6 in Placenta lysates. Antibody dilution at 1.0ug/ml

Applications for FCRL6/FcRH6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCRL6/FcRH6

Fc receptor homologs, also known as IRTA or IFGP (IgSF, FcR, gp42) proteins, are transmembrane proteins with sequence homology to classical Fc receptors. FcRH have from three to nine Ig-like domains in their extracellular region and variable combinations of cytoplasmic immunotyrosine activation or inhibitory motifs (ITAM or ITIM). FcRH function as activating or inhibitory receptors on discrete B cell populations and are involved in lymphocyte development and transformation. No ligands for these proteins have been identified.

Long Name

Fc Receptor-like 6

Alternate Names

FcRH6, IFGP6

Gene Symbol

FCRL6

Additional FCRL6/FcRH6 Products

Product Documents for FCRL6/FcRH6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FCRL6/FcRH6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FCRL6/FcRH6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FCRL6/FcRH6 Antibody - BSA Free and earn rewards!

Have you used FCRL6/FcRH6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies