FSTL4 (Follistatin-like protein 4; also FSL4, SPIG1 and D/Bsp120I-1) is a likely secreted, 90 kDa (predicted) member of the follistatin gene family of TGF-beta superfamily inhibitors. It is widely expressed, being found in neurons (retinal ganglion and cerebellar Purkinje cells), cardiac muscle cells, smooth muscle cells and intestinal epithelium. Mature mouse FSTL4 is 819 amino acids (aa) in length (aa 23-841). It contains one kazal-like domain (aa 80-134), an EF-hand motif (aa 173-208), and two Ig-like domains (aa 250-336 and 340-425). There are two potential splice forms, one that shows an alternative start site at Met315, and a second that possesses a His residue substitution for aa 518-841. Full-length mature mouse FSTL4 shares 95% and 84% aa identity with rat and human FSTL4, respectively.
Follistatin-like 4/FSTL4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-09413
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Follistatin-like 4/FSTL4. Peptide sequence VLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELA
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Follistatin-like 4/FSTL4 Antibody - BSA Free
Western Blot: Follistatin-like 4/FSTL4 Antibody [NBP3-09413]
Western Blot: Follistatin-like 4/FSTL4 Antibody [NBP3-09413] - Western blot analysis of Follistatin-like 4/FSTL4 in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/mlApplications for Follistatin-like 4/FSTL4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Follistatin-like 4/FSTL4
Alternate Names
Follistatin like 4, FSL4, FSTL4
Gene Symbol
FSTL4
Additional Follistatin-like 4/FSTL4 Products
Product Documents for Follistatin-like 4/FSTL4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Follistatin-like 4/FSTL4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Follistatin-like 4/FSTL4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Follistatin-like 4/FSTL4 Antibody - BSA Free and earn rewards!
Have you used Follistatin-like 4/FSTL4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...