Follistatin-like 4/FSTL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09413

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Follistatin-like 4/FSTL4. Peptide sequence VLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Follistatin-like 4/FSTL4 Antibody - BSA Free

Western Blot: Follistatin-like 4/FSTL4 Antibody [NBP3-09413]

Western Blot: Follistatin-like 4/FSTL4 Antibody [NBP3-09413]

Western Blot: Follistatin-like 4/FSTL4 Antibody [NBP3-09413] - Western blot analysis of Follistatin-like 4/FSTL4 in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for Follistatin-like 4/FSTL4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Follistatin-like 4/FSTL4

FSTL4 (Follistatin-like protein 4; also FSL4, SPIG1 and D/Bsp120I-1) is a likely secreted, 90 kDa (predicted) member of the follistatin gene family of TGF-beta superfamily inhibitors. It is widely expressed, being found in neurons (retinal ganglion and cerebellar Purkinje cells), cardiac muscle cells, smooth muscle cells and intestinal epithelium. Mature mouse FSTL4 is 819 amino acids (aa) in length (aa 23-841). It contains one kazal-like domain (aa 80-134), an EF-hand motif (aa 173-208), and two Ig-like domains (aa 250-336 and 340-425). There are two potential splice forms, one that shows an alternative start site at Met315, and a second that possesses a His residue substitution for aa 518-841. Full-length mature mouse FSTL4 shares 95% and 84% aa identity with rat and human FSTL4, respectively.

Alternate Names

Follistatin like 4, FSL4, FSTL4

Gene Symbol

FSTL4

Additional Follistatin-like 4/FSTL4 Products

Product Documents for Follistatin-like 4/FSTL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Follistatin-like 4/FSTL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Follistatin-like 4/FSTL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Follistatin-like 4/FSTL4 Antibody - BSA Free and earn rewards!

Have you used Follistatin-like 4/FSTL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...