FOXN4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09251

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FOXN4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXN4 (NP_998761). Peptide sequence QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FOXN4 Antibody - BSA Free

Western Blot: FOXN4 Antibody [NBP3-09251]

Western Blot: FOXN4 Antibody [NBP3-09251]

Western Blot: FOXN4 Antibody [NBP3-09251] - Western blot analysis using NBP3-09251 on Human OVCAR-3 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for FOXN4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXN4

Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-aminoacid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helicesflanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as keyregulators in development and metabolism (Li et al., 2004 (PubMed 15363391)).(supplied by OMIM)

Alternate Names

FLJ35967, forkhead box N4, forkhead box protein N4, forkhead/winged helix transcription factor FOXN4

Gene Symbol

FOXN4

Additional FOXN4 Products

Product Documents for FOXN4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXN4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXN4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXN4 Antibody - BSA Free and earn rewards!

Have you used FOXN4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies