FSTL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86638

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Follistatin-like 5/FSTL5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FSTL5. Peptide sequence: EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FSTL5 Antibody - BSA Free

Western Blot: FSTL5 Antibody [NBP2-86638]

Western Blot: FSTL5 Antibody [NBP2-86638]

Western Blot: FSTL5 Antibody [NBP2-86638] - WB Suggested Anti-FSTL5 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human heart

Applications for FSTL5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Follistatin-like 5/FSTL5

Follistatin-like 5 (FSTL5) is a secreted SPARC family protein that is expressed in the cartilage and tendon of developing digits and the shafts of long bones. In the brain it is expressed in the olfactory bulb, CA3 area of the hippocampus, and granule cell layer of the cerebellum. FSTL5 inhibits the proliferation and promotes the apoptosis of hepatocellular carcinoma cells. Its expression in medulloblastoma and downregulation in hepatocellular carcinoma are associated with poor prognosis.

Alternate Names

Follistatin like 5, FSL5, FSTL5

Gene Symbol

FSTL5

Additional Follistatin-like 5/FSTL5 Products

Product Documents for FSTL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FSTL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Activin Family

Customer Reviews for FSTL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FSTL5 Antibody - BSA Free and earn rewards!

Have you used FSTL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies