G protein beta 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79681

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all G protein beta 4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for G protein beta 4 Antibody - BSA Free

Western Blot: G protein beta 4 Antibody [NBP1-79681]

Western Blot: G protein beta 4 Antibody [NBP1-79681]

Western Blot: G protein beta 4 Antibody [NBP1-79681] - Titration: 0.2-1 ug/ml, Positive Control: HCT15 cell lysate.
Western Blot: G protein beta 4 Antibody [NBP1-79681]

Western Blot: G protein beta 4 Antibody [NBP1-79681]

Western Blot: G protein beta 4 Antibody [NBP1-79681] - Primary dilution: 1:1000 Secondary dilution: 1:10000 goat-anti-rabbit

Applications for G protein beta 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G protein beta 4

FUNCTION: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. SUBUNIT: G proteins are composed of 3 units, alpha, beta and gamma. TISSUE SPECIFICITY: Strongly expressed in lung and placenta, whereas it is weakly expressed in brain and heart.

Alternate Names

G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4

Gene Symbol

GNB4

UniProt

NP_067642 (Human)

Additional G protein beta 4 Products

Product Documents for G protein beta 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G protein beta 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G protein beta 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G protein beta 4 Antibody - BSA Free and earn rewards!

Have you used G protein beta 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies