Gabpb2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56677

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Gabpb2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gabpb2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Gabpb2 Antibody [NBP2-56677]

Immunocytochemistry/ Immunofluorescence: Gabpb2 Antibody [NBP2-56677]

Immunocytochemistry/Immunofluorescence: Gabpb2 Antibody [NBP2-56677] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Gabpb2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: Gabpb2 Antibody - BSA Free [NBP2-56677]

Chromatin Immunoprecipitation-exo-Seq: Gabpb2 Antibody - BSA Free [NBP2-56677]

ChIP-Exo-Seq composite graph for Anti-GABPB2 (NBP2-56677) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for Gabpb2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gabpb2

Gabpb2 encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-2, GABP subunit beta-2, GABPB-2, MGC29891

Gene Symbol

GABPB2

Additional Gabpb2 Products

Product Documents for Gabpb2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Gabpb2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gabpb2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gabpb2 Antibody - BSA Free and earn rewards!

Have you used Gabpb2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies