Galectin-12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10172

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Galectin-12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Galectin-12 (NP_062389.1). Peptide sequence HYRYRLPLSRVDTLDISGDILVKAVGFLNINPFVEGSREYPVGYPFLLYS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Galectin-12 Antibody - BSA Free

Western Blot: Galectin-12 Antibody [NBP3-10172]

Western Blot: Galectin-12 Antibody [NBP3-10172]

Western Blot: Galectin-12 Antibody [NBP3-10172] - Western blot analysis of Galectin-12 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Applications for Galectin-12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Galectin-12

LGALS12, also known as Galectin-12, is a protein with 6 isoforms ranging from 266 amino acid and 30 kDa to 366 amino acid and 38 kDa; predominantly expressed in adipose tissue; binds lactose and may play role in the apoptosis of adipocytes. There is no current information about this protein involvement in any disease or disorder. It has been shown that LGALS12 protein participates in apoptotic process and induction of apoptosis by intracellular signals pathways.

Alternate Names

Gal-12, GAL12, GRIP1, LGALS12

Gene Symbol

LGALS12

Additional Galectin-12 Products

Product Documents for Galectin-12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Galectin-12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Galectin-12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Galectin-12 Antibody - BSA Free and earn rewards!

Have you used Galectin-12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies