gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87486

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all gamma-Glutamylcyclotransferase/CRF21 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of gamma-Glutamylcyclotransferase/CRF21/GGCT. Peptide sequence: ESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

Western Blot: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP2-87486]

Western Blot: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP2-87486]

Western Blot: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP2-87486] - WB Suggested Anti-GGCT Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: gamma-Glutamylcyclotransferase/CRF21

CRF21 (Cytochrome c-releasing factor 21; also C7orf24 or LOC79017) is a 21 kDa AIG2-like family member. It is a cytosolic protein that induces the release of Cytochrome c from mitochondria, possibly initiating apoptosis. Human CRF21 is 188 amino acids (aa) in length and is a complex of beta-sheets and alpha-helices that create two terminal domains. It has been proposed that CRF21 forms homodimers. There are at least two possible splice variants of human CRF21, one showing a 70 aa substitution, while the second variant shows an 18 aa substitution for aa 97-188. Full-length human CRF21 is 82% aa identical to mouse CRF21.

Long Name

Cytochrome c Releasing Factor 21

Alternate Names

C7orf24, CRF21, gammaGlutamylcyclotransferase, GCTG, GGC, GGCT, LOC79017

Gene Symbol

GGCT

Additional gamma-Glutamylcyclotransferase/CRF21 Products

Product Documents for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free and earn rewards!

Have you used gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies