GAPDH Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-59025PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-59025PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: GAPDH
References
1) Barber RD, Harmer DW, Coleman RA, Clark BJ. (2005) GAPDH as a housekeeping gene: analysis of GAPDH mRNA expression in a panel of 72 human tissues. Physiol Genomics. 21(3):389-95. PMID: 15769908
2) Jia Y, Takimoto K. (2006) Mitogen-activated protein kinases control cardiac KChIP2 gene expression. Circ Res. 98(3):386-93. PMID: 16385079
3) Godsel LM, Hsieh SN, Amargo EV, Bass AE, Pascoe-McGillicuddy LT, Huen AC, Thorne ME, Gaudry CA, Park JK, Myung K, Goldman RD, Chew TL, Green KJ. (2005) Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin. J Cell Biol. 171(6):1045-59. PMID: 16365169
4) Sirover MA1. (1999) New insights into an old protein: the functional diversity of mammalian glyceraldehyde-3-phosphate dehydrogenase. Biochim Biophys Acta. 1432(2): 159-84. PMID: 10407139
5) Tristan C, Shahani N, Sedlak TW, Sawa A. (2011) The diverse functions of GAPDH: views from different subcellular compartments. Cell Signal. 23(2):317-23. PMID: 20727968
Long Name
Alternate Names
Gene Symbol
Additional GAPDH Products
Product Documents for GAPDH Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GAPDH Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for GAPDH Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review GAPDH Recombinant Protein Antigen and earn rewards!
Have you used GAPDH Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for GAPDH Recombinant Protein Antigen
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.
-
Q: Do you offer a smaller size for the GAPDH antibodies?
A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.
-
Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?
A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.
-
Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.
A: Our GAPDH antibody makes a good loading control because GAPDH is a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.
-
Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.
A: For homogenized tissue, beta-actin and GAPDH are both fine.
-
Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody we already had but it didn't work. What can you recommend?
A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.
-
Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?
A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.
-
Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.
A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul.
-
Q: What secondary antibody should I use for visualization of the GAPDH antibody?
A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.