GARNL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82874

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GARNL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GARNL1. Peptide sequence: MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GARNL1 Antibody - BSA Free

Western Blot: GARNL1 Antibody [NBP2-82874]

Western Blot: GARNL1 Antibody [NBP2-82874]

Western Blot: GARNL1 Antibody [NBP2-82874] - Host: Rabbit. Target Name: RALGAPA1. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for GARNL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GARNL1

Interacting partner of the transcription factor TCF3/isoform E12, mainly in the developing embryonicforebrain. May be an important transcriptional regulator of downstream target genes under the control of TCF3/E12, bydisrupting HLH dimer formation of TCF3/E12 with other proteins. May be involved in neuronal differentiation (Bysimilarity)

Alternate Names

DKFZp566D133, DKFZp667F074, GAP-related interacting protein to E12, GARNL1p240, GRIPEGAP-related-interacting partner to E12, GTPase activating RANGAP domain-like 1, GTPase activating Rap/RanGAP domain-like 1, KIAA0884GTPase-activating Rap/Ran-GAP domain-like 1, Ral GTPase activating protein, alpha subunit 1 (catalytic), ral GTPase-activating protein alpha subunit 1, ral GTPase-activating protein subunit alpha-1, RalGAPalpha1, Tuberin-like protein 1, TULIP1Tulip1

Gene Symbol

RALGAPA1

Additional GARNL1 Products

Product Documents for GARNL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GARNL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GARNL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GARNL1 Antibody - BSA Free and earn rewards!

Have you used GARNL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies