GBL Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-38491PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLST8.

Source: E. coli

Amino Acid Sequence: SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38491.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-38491PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GBL

G-protein beta-subunit-like (GBL), also known as MTOR Associated Protein, LST8 Homolog (mLST8), is a 326 amino acid (aa) protein that is comprised of seven WD40 repeats and has a predicted molecular weight of approximately 36 kDa. The human protein shares 97% aa sequence identity with the mouse and rat orthologs. GBL binds the kinase domain of TOR and has been shown to stimulate its activity. GBL is found in both complexes formed by TOR, TORC1 and TORC2. It is required for TORC1-dependent phosphorylation of p70 S6 Kinase and IRS1 following stimulation with serum and insulin, and TORC2-dependent phosphorylation of Akt on Ser473 in response to serum, Insulin, and IFN-beta. GBL also negatively regulates TNF-alpha-induced NFkB activation via binding to IKK alpha and IKK beta. The physiological importance of GBL is highlighted by the fact that knockout mice display embryonic lethality, possibly due to defective vascular development. Additionally, female mice harboring heterozygous null mutations for both TOR and GBL have an increased life span, suggesting that GBL may also be involved in the aging process.

Long Name

G protein beta subunit-like

Alternate Names

mLST8

Gene Symbol

MLST8

Additional GBL Products

Product Documents for GBL Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GBL Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for GBL Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review GBL Recombinant Protein Antigen and earn rewards!

Have you used GBL Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes