GCOM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56359

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GCOM1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GCOM1 The peptide sequence was selected from the middle region of GCOM1. Peptide sequence VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GCOM1 Antibody - BSA Free

Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359] - COLO205 cells lysate, concentration 0.2-1 ug/ml.
Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359]

Western Blot: GCOM1 Antibody [NBP1-56359] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for GCOM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCOM1

This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants. This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.

Alternate Names

Gcom, GRINL1A combined protein, GRINL1A upstream protein, Gup

Gene Symbol

GCOM1

Additional GCOM1 Products

Product Documents for GCOM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GCOM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCOM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCOM1 Antibody - BSA Free and earn rewards!

Have you used GCOM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies