GFER/ALR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87495

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GFER/ALR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GFER/ALR. Peptide sequence: LCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GFER/ALR Antibody - BSA Free

Western Blot: GFER/ALR Antibody [NBP2-87495]

Western Blot: GFER/ALR Antibody [NBP2-87495]

Western Blot: GFER/ALR Antibody [NBP2-87495] - Host: Rabbit. Target Name: ALR. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for GFER/ALR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFER/ALR

The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factorsresponsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepaticregenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus forpolycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeastscERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes,and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.(provided by RefSeq)

Long Name

Growth Factor, Augmenter of Liver Regeneration

Alternate Names

ALR, ERV1, Hepatopoietin, HERV1, HPO

Gene Symbol

GFER

Additional GFER/ALR Products

Product Documents for GFER/ALR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GFER/ALR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Oxidases and Oxygenases
Redox Enzymes

Customer Reviews for GFER/ALR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFER/ALR Antibody - BSA Free and earn rewards!

Have you used GFER/ALR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies