GFM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98458

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GFM1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Gfm1 - C-terminal region. Peptide sequence ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GFM1 Antibody - BSA Free

Western Blot: GFM1 Antibody [NBP1-98458]

Western Blot: GFM1 Antibody [NBP1-98458]

Western Blot: GFM1 Antibody [NBP1-98458] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for GFM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFM1

Gfm1 is a mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Gfm1 catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Gfm1 does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis.

Alternate Names

EFG, EFG1FLJ12662, EFGM, EF-Gmt, EGF1, FLJ13632, FLJ20773, G elongation factor, mitochondrial 1, G translation elongation factor, mitochondrial, GFMCOXPD1, hEFG1, mEF-G 1, mitochondrial, mitochondrial elongation factor G, mitochondrial elongation factor G1

Gene Symbol

GFM1

UniProt

NP_613057 (Mouse)

Additional GFM1 Products

Product Documents for GFM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GFM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GFM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFM1 Antibody - BSA Free and earn rewards!

Have you used GFM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies