Catalog Number: 2257
Alternate Names: Gastric Inhibitory Polypeptide (1-39)
Biological Activity
Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).
Technical Data
  • M.Wt:
    4633.21
  • Formula:
    C210H316N56O61S
  • Sequence:
    YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
  • Solubility:
    Soluble to 10 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    725474-97-5
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. GIP1-39, a novel insulinotropic peptide form and aspects on its mechanism of action.
    Xie et al.
    Regul.Peptides, 2004;121:107

Have you used GIP (1-39)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information