GIP (1-39)

Catalog # Availability Size / Price Qty
2257/1
GIP (1-39)
1 Image
Description: Highly potent insulinotropic peptide; GIP agonist
Alternative Names: Gastric Inhibitory Polypeptide (1-39)
Product Details
Reviews

Biological Activity

Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).

Technical Data

M.Wt:
4633.21
Formula:
C210H316N56O61S
Sequence:
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Solubility:
Soluble to 10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
725474-97-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. GIP1-39, a novel Insotropic peptide form and aspects on its mechanism of action.
    Xie et al.
    Regul.Peptides, 2004;121:107

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for GIP (1-39)

There are currently no reviews for this product. Be the first to review GIP (1-39) and earn rewards!

Have you used GIP (1-39)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.