Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

Novus Biologicals | Catalog # NBP3-15359

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6V8O9 expressed in HEK293
View all G6PD Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Glucose 6 Phosphate Dehydrogenase (P11413). VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) [NBP3-15359]

Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) [NBP3-15359]

Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) [NBP3-15359] - Western blot analysis of extracts of various cell lines, using Glucose 6 Phosphate Dehydrogenase Rabbit mAb (NBP3-15359) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Applications for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: G6PD

Glucose-6-phosphate dehydrogenase (G6PD) is a cytosolic enzyme that catalyzes the conversion of glucose-6-phosphate into 6-phosphgluconolactone and maintains the levels of the electron donor, NADPH. G6PD is an x-linked housekeeping gene whose deficiency can result in neonatal jaundice, acute hemolysis, or chronic non-spherocytic hemolytic anemia.

Long Name

Glucose-6-Phosphate Dehydrogenase

Alternate Names

G6PDH

Gene Symbol

G6PD

Additional G6PD Products

Product Documents for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)

There are currently no reviews for this product. Be the first to review Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) and earn rewards!

Have you used Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies