Glut3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09953

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Glut3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Glut3 (NP_008862). Peptide sequence RQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glut3 Antibody - BSA Free

Western Blot: Glut3 Antibody [NBP3-09953]

Western Blot: Glut3 Antibody [NBP3-09953]

Western Blot: Glut3 Antibody [NBP3-09953] - Western blot analysis of Glut3 in Human MCF7 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Glut3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glut3

Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.

Long Name

Glucose Transporter Type 3

Alternate Names

SLC2A3

Gene Symbol

SLC2A3

Additional Glut3 Products

Product Documents for Glut3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glut3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glut3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glut3 Antibody - BSA Free and earn rewards!

Have you used Glut3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies