Glyoxalase I Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56695

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glyoxalase I Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK

Reactivity Notes

Mouse 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glyoxalase I Antibody - BSA Free

Western Blot: Glyoxalase I Antibody [NBP2-56695]

Western Blot: Glyoxalase I Antibody [NBP2-56695]

Western Blot: Glyoxalase I Antibody [NBP2-56695] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Glyoxalase I Antibody [NBP2-56695]

Immunocytochemistry/ Immunofluorescence: Glyoxalase I Antibody [NBP2-56695]

Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody [NBP2-56695] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.

Applications for Glyoxalase I Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glyoxalase I

Lactoylglutathione lyase, also known as GLO1, is a member of the glyoxalase I family that is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. It is believed that inactivation of GLO1 in endothelial cells contributes to vascular complications in diabetes. GLO1 has also been shown to extend lifespan in C. elegans, and has been shown to be upregulated in malignant cells.

Alternate Names

Aldoketomutase, GLO1, GLOD1, Glx I, GLYI, Methylglyoxalase

Gene Symbol

GLO1

Additional Glyoxalase I Products

Product Documents for Glyoxalase I Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glyoxalase I Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glyoxalase I Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glyoxalase I Antibody - BSA Free and earn rewards!

Have you used Glyoxalase I Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies