GM2A Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-87090PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all GM2A Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GM2A.

Source: E. coli

Amino Acid Sequence: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87090.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-87090PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GM2A

GM2A, also known as Ganglioside GM2 activator, is a 193 amino acid that is 21 kDa, with lysosome subcellular location, acts as s a lipid transfer protein that stimulates the enzymatic processing of gangliosides and T-cell activation; acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A which, together with this activator, catalyzes the degradation of the ganglioside GM2; also displays some calcium-independent phospholipase activity. Disease research on this protein has shown a relationship with tay-sachs disease, gangliosidosis, gangliosidosis gm2, sandhoff disease, neurological disorder, candidiasis, protein s deficiency, neurodegenerative disease, tay-sachs disease ab variant, spinal muscular atrophy, lysosomal storage disease, muscular atrophy, sinusitis, gastric cancer, cholesterol, and neuronitis. The GM2A protein has also shown an interaction with PLD2, GPLD1 and HEXA in the Sphingolipid metabolism, glycosphingolipid metabolism, lysosome, and phospholipid metabolism pathways.

Alternate Names

Cerebroside sulfate activator protein, ganglioside GM2 activator, GM2 ganglioside activator, GM2-AP, SAP-3GM2 ganglioside activator protein, Shingolipid activator protein 3, sphingolipid activator protein 3

Gene Symbol

GM2A

Additional GM2A Products

Product Documents for GM2A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GM2A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for GM2A Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review GM2A Recombinant Protein Antigen and earn rewards!

Have you used GM2A Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes