GP-IX Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79895

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPIX Primary Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GP-IX Antibody - BSA Free

Western Blot: GP-IX Antibody [NBP1-79895]

Western Blot: GP-IX Antibody [NBP1-79895]

Western Blot: GP-IX Antibody [NBP1-79895] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

Applications for GP-IX Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPIX

CD42a is a small membrane glycoprotein found on the surface of human platelets. It forms a one to one noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The main portion of the receptor is a heterodimer composed of 2 polypeptide chains, an alpha chain and a beta chain, that are linked by disulfide bonds. The complete receptor complex includes noncovalent association of the alpha and beta subunits with GP9 and platelet glycoprotein V. CD42a is present on thrombocytes and also on a so far unidentified subpopulation of T lymphocytes.

Long Name

Glycoprotein IX (platelet)

Alternate Names

CD42a, GP9

Gene Symbol

GP9

UniProt

NP_000165

Additional GPIX Products

Product Documents for GP-IX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GP-IX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Coagulation

Customer Reviews for GP-IX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GP-IX Antibody - BSA Free and earn rewards!

Have you used GP-IX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies